S100A2 polyclonal antibody (A01)
  • S100A2 polyclonal antibody (A01)

S100A2 polyclonal antibody (A01)

Ref: AB-H00006273-A01
S100A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant S100A2.
Información adicional
Size 50 uL
Gene Name S100A2
Gene Alias CAN19|MGC111539|S100L
Gene Description S100 calcium binding protein A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6273

Enviar un mensaje


S100A2 polyclonal antibody (A01)

S100A2 polyclonal antibody (A01)