RXRA monoclonal antibody (M17), clone 1G1
  • RXRA monoclonal antibody (M17), clone 1G1

RXRA monoclonal antibody (M17), clone 1G1

Ref: AB-H00006256-M17
RXRA monoclonal antibody (M17), clone 1G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RXRA.
Información adicional
Size 100 ug
Gene Name RXRA
Gene Alias FLJ00280|FLJ00318|FLJ16020|FLJ16733|MGC102720|NR2B1
Gene Description retinoid X receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RXRA (NP_002948, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6256
Clone Number 1G1
Iso type IgG2a Kappa

Enviar un mensaje


RXRA monoclonal antibody (M17), clone 1G1

RXRA monoclonal antibody (M17), clone 1G1