RSU1 monoclonal antibody (M01), clone 1C6
  • RSU1 monoclonal antibody (M01), clone 1C6

RSU1 monoclonal antibody (M01), clone 1C6

Ref: AB-H00006251-M01
RSU1 monoclonal antibody (M01), clone 1C6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RSU1.
Información adicional
Size 100 ug
Gene Name RSU1
Gene Alias FLJ31034|RSP-1
Gene Description Ras suppressor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RSU1 (AAH05993, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6251
Clone Number 1C6
Iso type IgG1 Kappa

Enviar un mensaje


RSU1 monoclonal antibody (M01), clone 1C6

RSU1 monoclonal antibody (M01), clone 1C6