RSC1A1 monoclonal antibody (M01), clone 6F9
  • RSC1A1 monoclonal antibody (M01), clone 6F9

RSC1A1 monoclonal antibody (M01), clone 6F9

Ref: AB-H00006248-M01
RSC1A1 monoclonal antibody (M01), clone 6F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RSC1A1.
Información adicional
Size 100 ug
Gene Name RSC1A1
Gene Alias RS1
Gene Description regulatory solute carrier protein, family 1, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKEHLSLQDLSDHASSADHAPTDQSPAMPMQNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RSC1A1 (NP_006502, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6248
Clone Number 6F9
Iso type IgG1 Kappa

Enviar un mensaje


RSC1A1 monoclonal antibody (M01), clone 6F9

RSC1A1 monoclonal antibody (M01), clone 6F9