RRM2 monoclonal antibody (M01A), clone 1E1
  • RRM2 monoclonal antibody (M01A), clone 1E1

RRM2 monoclonal antibody (M01A), clone 1E1

Ref: AB-H00006241-M01A
RRM2 monoclonal antibody (M01A), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RRM2.
Información adicional
Size 200 uL
Gene Name RRM2
Gene Alias R2|RR2M
Gene Description ribonucleotide reductase M2 polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6241
Clone Number 1E1
Iso type IgG1 Kappa

Enviar un mensaje


RRM2 monoclonal antibody (M01A), clone 1E1

RRM2 monoclonal antibody (M01A), clone 1E1