RPS28 monoclonal antibody (M02), clone 2F9
  • RPS28 monoclonal antibody (M02), clone 2F9

RPS28 monoclonal antibody (M02), clone 2F9

Ref: AB-H00006234-M02
RPS28 monoclonal antibody (M02), clone 2F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS28.
Información adicional
Size 100 ug
Gene Name RPS28
Gene Alias -
Gene Description ribosomal protein S28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS28 (NP_001022, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6234
Clone Number 2F9
Iso type IgG2a Kappa

Enviar un mensaje


RPS28 monoclonal antibody (M02), clone 2F9

RPS28 monoclonal antibody (M02), clone 2F9