RPS23 monoclonal antibody (M02), clone 1E3
  • RPS23 monoclonal antibody (M02), clone 1E3

RPS23 monoclonal antibody (M02), clone 1E3

Ref: AB-H00006228-M02
RPS23 monoclonal antibody (M02), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS23.
Información adicional
Size 100 ug
Gene Name RPS23
Gene Alias FLJ35016
Gene Description ribosomal protein S23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS23 (NP_001016, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6228
Clone Number 1E3
Iso type IgG2a Kappa

Enviar un mensaje


RPS23 monoclonal antibody (M02), clone 1E3

RPS23 monoclonal antibody (M02), clone 1E3