RPS23 polyclonal antibody (A01)
  • RPS23 polyclonal antibody (A01)

RPS23 polyclonal antibody (A01)

Ref: AB-H00006228-A01
RPS23 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS23.
Información adicional
Size 50 uL
Gene Name RPS23
Gene Alias FLJ35016
Gene Description ribosomal protein S23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS23 (NP_001016, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6228

Enviar un mensaje


RPS23 polyclonal antibody (A01)

RPS23 polyclonal antibody (A01)