RPS17 monoclonal antibody (M01), clone 2C7
  • RPS17 monoclonal antibody (M01), clone 2C7

RPS17 monoclonal antibody (M01), clone 2C7

Ref: AB-H00006218-M01
RPS17 monoclonal antibody (M01), clone 2C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS17.
Información adicional
Size 50 ug
Gene Name RPS17
Gene Alias DBA4|MGC72007|RPS17L1|RPS17L2
Gene Description ribosomal protein S17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS17 (NP_001012, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6218
Clone Number 2C7
Iso type IgG1 Kappa

Enviar un mensaje


RPS17 monoclonal antibody (M01), clone 2C7

RPS17 monoclonal antibody (M01), clone 2C7