RPS9 polyclonal antibody (A01)
  • RPS9 polyclonal antibody (A01)

RPS9 polyclonal antibody (A01)

Ref: AB-H00006203-A01
RPS9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS9.
Información adicional
Size 50 uL
Gene Name RPS9
Gene Alias -
Gene Description ribosomal protein S9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS9 (NP_001004, 105 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6203

Enviar un mensaje


RPS9 polyclonal antibody (A01)

RPS9 polyclonal antibody (A01)