RPS7 polyclonal antibody (A01)
  • RPS7 polyclonal antibody (A01)

RPS7 polyclonal antibody (A01)

Ref: AB-H00006201-A01
RPS7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS7.
Información adicional
Size 50 uL
Gene Name RPS7
Gene Alias -
Gene Description ribosomal protein S7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6201

Enviar un mensaje


RPS7 polyclonal antibody (A01)

RPS7 polyclonal antibody (A01)