RPS6KB2 monoclonal antibody (M08), clone 4B11
  • RPS6KB2 monoclonal antibody (M08), clone 4B11

RPS6KB2 monoclonal antibody (M08), clone 4B11

Ref: AB-H00006199-M08
RPS6KB2 monoclonal antibody (M08), clone 4B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS6KB2.
Información adicional
Size 100 ug
Gene Name RPS6KB2
Gene Alias KLS|P70-beta|P70-beta-1|P70-beta-2|S6K-beta2|S6K2|SRK|STK14B|p70(S6K)-beta|p70S6Kb
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6199
Clone Number 4B11
Iso type IgG2a Kappa

Enviar un mensaje


RPS6KB2 monoclonal antibody (M08), clone 4B11

RPS6KB2 monoclonal antibody (M08), clone 4B11