RPS6KB2 polyclonal antibody (A01)
  • RPS6KB2 polyclonal antibody (A01)

RPS6KB2 polyclonal antibody (A01)

Ref: AB-H00006199-A01
RPS6KB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS6KB2.
Información adicional
Size 50 uL
Gene Name RPS6KB2
Gene Alias KLS|P70-beta|P70-beta-1|P70-beta-2|S6K-beta2|S6K2|SRK|STK14B|p70(S6K)-beta|p70S6Kb
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6199

Enviar un mensaje


RPS6KB2 polyclonal antibody (A01)

RPS6KB2 polyclonal antibody (A01)