RPS6KB1 monoclonal antibody (M04), clone 4H4
  • RPS6KB1 monoclonal antibody (M04), clone 4H4

RPS6KB1 monoclonal antibody (M04), clone 4H4

Ref: AB-H00006198-M04
RPS6KB1 monoclonal antibody (M04), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.
Información adicional
Size 100 ug
Gene Name RPS6KB1
Gene Alias PS6K|S6K|S6K1|STK14A|p70(S6K)-alpha|p70-S6K|p70-alpha
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6198
Clone Number 4H4
Iso type IgG1 Kappa

Enviar un mensaje


RPS6KB1 monoclonal antibody (M04), clone 4H4

RPS6KB1 monoclonal antibody (M04), clone 4H4