RPS6KA3 polyclonal antibody (A01)
  • RPS6KA3 polyclonal antibody (A01)

RPS6KA3 polyclonal antibody (A01)

Ref: AB-H00006197-A01
RPS6KA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS6KA3.
Información adicional
Size 50 uL
Gene Name RPS6KA3
Gene Alias CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KA3 (NP_004577, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6197

Enviar un mensaje


RPS6KA3 polyclonal antibody (A01)

RPS6KA3 polyclonal antibody (A01)