RPS3 monoclonal antibody (M03), clone 2A8
  • RPS3 monoclonal antibody (M03), clone 2A8

RPS3 monoclonal antibody (M03), clone 2A8

Ref: AB-H00006188-M03
RPS3 monoclonal antibody (M03), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS3.
Información adicional
Size 100 ug
Gene Name RPS3
Gene Alias FLJ26283|FLJ27450|MGC87870
Gene Description ribosomal protein S3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS3 (NP_000996, 144 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6188
Clone Number 2A8
Iso type IgG2a Kappa

Enviar un mensaje


RPS3 monoclonal antibody (M03), clone 2A8

RPS3 monoclonal antibody (M03), clone 2A8