RPS2 polyclonal antibody (A01)
  • RPS2 polyclonal antibody (A01)

RPS2 polyclonal antibody (A01)

Ref: AB-H00006187-A01
RPS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS2.
Información adicional
Size 50 uL
Gene Name RPS2
Gene Alias LLREP3|MGC102851|MGC117344|MGC117345
Gene Description ribosomal protein S2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6187

Enviar un mensaje


RPS2 polyclonal antibody (A01)

RPS2 polyclonal antibody (A01)