RPL32 monoclonal antibody (M01), clone 1C3
  • RPL32 monoclonal antibody (M01), clone 1C3

RPL32 monoclonal antibody (M01), clone 1C3

Ref: AB-H00006161-M01
RPL32 monoclonal antibody (M01), clone 1C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL32.
Información adicional
Size 100 ug
Gene Name RPL32
Gene Alias PP9932
Gene Description ribosomal protein L32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL32 (NP_000985, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6161
Clone Number 1C3
Iso type IgG2a Kappa

Enviar un mensaje


RPL32 monoclonal antibody (M01), clone 1C3

RPL32 monoclonal antibody (M01), clone 1C3