RPL32 polyclonal antibody (A01)
  • RPL32 polyclonal antibody (A01)

RPL32 polyclonal antibody (A01)

Ref: AB-H00006161-A01
RPL32 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL32.
Información adicional
Size 50 uL
Gene Name RPL32
Gene Alias PP9932
Gene Description ribosomal protein L32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL32 (NP_000985, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6161

Enviar un mensaje


RPL32 polyclonal antibody (A01)

RPL32 polyclonal antibody (A01)