RPL31 polyclonal antibody (A01)
  • RPL31 polyclonal antibody (A01)

RPL31 polyclonal antibody (A01)

Ref: AB-H00006160-A01
RPL31 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL31.
Información adicional
Size 50 uL
Gene Name RPL31
Gene Alias MGC88191
Gene Description ribosomal protein L31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL31 (NP_000984, 36 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6160

Enviar un mensaje


RPL31 polyclonal antibody (A01)

RPL31 polyclonal antibody (A01)