RPL17 monoclonal antibody (M01), clone 3G11
  • RPL17 monoclonal antibody (M01), clone 3G11

RPL17 monoclonal antibody (M01), clone 3G11

Ref: AB-H00006139-M01
RPL17 monoclonal antibody (M01), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RPL17.
Información adicional
Size 100 ug
Gene Name RPL17
Gene Alias FLJ92089|MGC117162|rpL23
Gene Description ribosomal protein L17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA,IF
Immunogen Prot. Seq MVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL17 (AAH00502, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6139
Clone Number 3G11
Iso type IgG2a Kappa

Enviar un mensaje


RPL17 monoclonal antibody (M01), clone 3G11

RPL17 monoclonal antibody (M01), clone 3G11