RPL11 polyclonal antibody (A01)
  • RPL11 polyclonal antibody (A01)

RPL11 polyclonal antibody (A01)

Ref: AB-H00006135-A01
RPL11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL11.
Información adicional
Size 50 uL
Gene Name RPL11
Gene Alias GIG34
Gene Description ribosomal protein L11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL11 (NP_000966, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6135

Enviar un mensaje


RPL11 polyclonal antibody (A01)

RPL11 polyclonal antibody (A01)