RPL8 polyclonal antibody (A01)
  • RPL8 polyclonal antibody (A01)

RPL8 polyclonal antibody (A01)

Ref: AB-H00006132-A01
RPL8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL8.
Información adicional
Size 50 uL
Gene Name RPL8
Gene Alias -
Gene Description ribosomal protein L8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL8 (NP_000964, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6132

Enviar un mensaje


RPL8 polyclonal antibody (A01)

RPL8 polyclonal antibody (A01)