RPE purified MaxPab rabbit polyclonal antibody (D01P)
  • RPE purified MaxPab rabbit polyclonal antibody (D01P)

RPE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006120-D01P
RPE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPE protein.
Información adicional
Size 100 ug
Gene Name RPE
Gene Alias MGC2636|RPE2-1
Gene Description ribulose-5-phosphate-3-epimerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPE (NP_954699.1, 1 a.a. ~ 228 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6120

Enviar un mensaje


RPE purified MaxPab rabbit polyclonal antibody (D01P)

RPE purified MaxPab rabbit polyclonal antibody (D01P)