RP2 monoclonal antibody (M02), clone 5C10
  • RP2 monoclonal antibody (M02), clone 5C10

RP2 monoclonal antibody (M02), clone 5C10

Ref: AB-H00006102-M02
RP2 monoclonal antibody (M02), clone 5C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RP2.
Información adicional
Size 100 ug
Gene Name RP2
Gene Alias DELXp11.3|KIAA0215|TBCCD2
Gene Description retinitis pigmentosa 2 (X-linked recessive)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RP2 (NP_008846, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6102
Clone Number 5C10
Iso type IgG2b Kappa

Enviar un mensaje


RP2 monoclonal antibody (M02), clone 5C10

RP2 monoclonal antibody (M02), clone 5C10