RORA monoclonal antibody (M01), clone 4E3
  • RORA monoclonal antibody (M01), clone 4E3

RORA monoclonal antibody (M01), clone 4E3

Ref: AB-H00006095-M01
RORA monoclonal antibody (M01), clone 4E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RORA.
Información adicional
Size 100 ug
Gene Name RORA
Gene Alias DKFZp686M2414|MGC119326|MGC119329|NR1F1|ROR1|ROR2|ROR3|RZR-ALPHA|RZRA
Gene Description RAR-related orphan receptor A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RORA (NP_599023, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6095
Clone Number 4E3
Iso type IgG1 Kappa

Enviar un mensaje


RORA monoclonal antibody (M01), clone 4E3

RORA monoclonal antibody (M01), clone 4E3