RORA purified MaxPab rabbit polyclonal antibody (D01P)
  • RORA purified MaxPab rabbit polyclonal antibody (D01P)

RORA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006095-D01P
RORA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RORA protein.
Información adicional
Size 100 ug
Gene Name RORA
Gene Alias DKFZp686M2414|MGC119326|MGC119329|NR1F1|ROR1|ROR2|ROR3|RZR-ALPHA|RZRA
Gene Description RAR-related orphan receptor A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MMYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RORA (NP_599024.1, 1 a.a. ~ 468 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6095

Enviar un mensaje


RORA purified MaxPab rabbit polyclonal antibody (D01P)

RORA purified MaxPab rabbit polyclonal antibody (D01P)