RORA polyclonal antibody (A01)
  • RORA polyclonal antibody (A01)

RORA polyclonal antibody (A01)

Ref: AB-H00006095-A01
RORA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RORA.
Información adicional
Size 50 uL
Gene Name RORA
Gene Alias DKFZp686M2414|MGC119326|MGC119329|NR1F1|ROR1|ROR2|ROR3|RZR-ALPHA|RZRA
Gene Description RAR-related orphan receptor A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RORA (NP_599023, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6095

Enviar un mensaje


RORA polyclonal antibody (A01)

RORA polyclonal antibody (A01)