ROM1 purified MaxPab mouse polyclonal antibody (B01P)
  • ROM1 purified MaxPab mouse polyclonal antibody (B01P)

ROM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006094-B01P
ROM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ROM1 protein.
Información adicional
Size 50 ug
Gene Name ROM1
Gene Alias ROM|ROSP1|TSPAN23
Gene Description retinal outer segment membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Ti,WB-Tr
Immunogen Prot. Seq MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVALGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ROM1 (NP_000318.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6094

Enviar un mensaje


ROM1 purified MaxPab mouse polyclonal antibody (B01P)

ROM1 purified MaxPab mouse polyclonal antibody (B01P)