Ver mas grande
ROBO1 monoclonal antibody (M03), clone 1F8
AB-H00006091-M03
Producto nuevo
ROBO1 monoclonal antibody (M03), clone 1F8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ROBO1 |
| Gene Alias | DUTT1|FLJ21882|MGC131599|MGC133277|SAX3 |
| Gene Description | roundabout, axon guidance receptor, homolog 1 (Drosophila) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ROBO1 (NP_002932, 491 a.a. ~ 589 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6091 |
| Clone Number | 1F8 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ROBO1.