RNPEP monoclonal antibody (M02), clone 4E1
  • RNPEP monoclonal antibody (M02), clone 4E1

RNPEP monoclonal antibody (M02), clone 4E1

Ref: AB-H00006051-M02
RNPEP monoclonal antibody (M02), clone 4E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNPEP.
Información adicional
Size 100 ug
Gene Name RNPEP
Gene Alias DKFZp547H084
Gene Description arginyl aminopeptidase (aminopeptidase B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNPEP (NP_064601, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6051
Clone Number 4E1
Iso type IgG2b Kappa

Enviar un mensaje


RNPEP monoclonal antibody (M02), clone 4E1

RNPEP monoclonal antibody (M02), clone 4E1