RNPEP purified MaxPab rabbit polyclonal antibody (D01P)
  • RNPEP purified MaxPab rabbit polyclonal antibody (D01P)

RNPEP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006051-D01P
RNPEP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RNPEP protein.
Información adicional
Size 100 ug
Gene Name RNPEP
Gene Alias DKFZp547H084
Gene Description arginyl aminopeptidase (aminopeptidase B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASGEHSPGSGAARRPLHSAQAVDVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLSGTAVLDLRCLEPEGAAELRLDSHPCLEVTAAALRRERPGSEEPPAEPVSFYTQPFSHYGQALCVSFPQPCRAAERLQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFFFQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNPEP (NP_064601.3, 1 a.a. ~ 650 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6051

Enviar un mensaje


RNPEP purified MaxPab rabbit polyclonal antibody (D01P)

RNPEP purified MaxPab rabbit polyclonal antibody (D01P)