RNH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • RNH1 purified MaxPab rabbit polyclonal antibody (D01P)

RNH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006050-D01P
RNH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RNH1 protein.
Información adicional
Size 100 ug
Gene Name RNH1
Gene Alias MGC18200|MGC4569|MGC54054|RAI|RNH
Gene Description ribonuclease/angiogenin inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNH1 (NP_002930.2, 1 a.a. ~ 461 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6050

Enviar un mensaje


RNH1 purified MaxPab rabbit polyclonal antibody (D01P)

RNH1 purified MaxPab rabbit polyclonal antibody (D01P)