RNF6 monoclonal antibody (M01), clone 3B1
  • RNF6 monoclonal antibody (M01), clone 3B1

RNF6 monoclonal antibody (M01), clone 3B1

Ref: AB-H00006049-M01
RNF6 monoclonal antibody (M01), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF6.
Información adicional
Size 100 ug
Gene Name RNF6
Gene Alias DKFZp686P0776
Gene Description ring finger protein (C3H2C3 type) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNQSRSRSDGGSEETLPQDHNHHENERRWQQERLHREEAYYQFINELNDEDYRLMRDHNLLGTPGEITSEELQQRLDGVKEQLASQPDLRDGTNYRDSEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF6 (NP_005968, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6049
Clone Number 3B1
Iso type IgG2a Kappa

Enviar un mensaje


RNF6 monoclonal antibody (M01), clone 3B1

RNF6 monoclonal antibody (M01), clone 3B1