RNASE2 purified MaxPab mouse polyclonal antibody (B01P)
  • RNASE2 purified MaxPab mouse polyclonal antibody (B01P)

RNASE2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006036-B01P
RNASE2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNASE2 protein.
Información adicional
Size 50 ug
Gene Name RNASE2
Gene Alias EDN|RNS2
Gene Description ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNASE2 (NP_002925.1, 1 a.a. ~ 161 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6036

Enviar un mensaje


RNASE2 purified MaxPab mouse polyclonal antibody (B01P)

RNASE2 purified MaxPab mouse polyclonal antibody (B01P)