RING1 monoclonal antibody (M10), clone 1F4
  • RING1 monoclonal antibody (M10), clone 1F4

RING1 monoclonal antibody (M10), clone 1F4

Ref: AB-H00006015-M10
RING1 monoclonal antibody (M10), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RING1.
Información adicional
Size 100 ug
Gene Name RING1
Gene Alias RING1A|RNF1
Gene Description ring finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RING1 (NP_002922, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6015
Clone Number 1F4
Iso type IgG2b Kappa

Enviar un mensaje


RING1 monoclonal antibody (M10), clone 1F4

RING1 monoclonal antibody (M10), clone 1F4