RGS16 polyclonal antibody (A01)
  • RGS16 polyclonal antibody (A01)

RGS16 polyclonal antibody (A01)

Ref: AB-H00006004-A01
RGS16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RGS16.
Información adicional
Size 50 uL
Gene Name RGS16
Gene Alias A28-RGS14|A28-RGS14P|RGS-R
Gene Description regulator of G-protein signaling 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS16 (NP_002919, 90 a.a. ~ 179 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6004

Enviar un mensaje


RGS16 polyclonal antibody (A01)

RGS16 polyclonal antibody (A01)