RGS13 monoclonal antibody (M06), clone 1B3
  • RGS13 monoclonal antibody (M06), clone 1B3

RGS13 monoclonal antibody (M06), clone 1B3

Ref: AB-H00006003-M06
RGS13 monoclonal antibody (M06), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGS13.
Información adicional
Size 100 ug
Gene Name RGS13
Gene Alias MGC17173
Gene Description regulator of G-protein signaling 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS13 (NP_658912.1, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6003
Clone Number 1B3
Iso type IgG2b Kappa

Enviar un mensaje


RGS13 monoclonal antibody (M06), clone 1B3

RGS13 monoclonal antibody (M06), clone 1B3