RGS3 monoclonal antibody (M01), clone 1E8-C7
  • RGS3 monoclonal antibody (M01), clone 1E8-C7

RGS3 monoclonal antibody (M01), clone 1E8-C7

Ref: AB-H00005998-M01
RGS3 monoclonal antibody (M01), clone 1E8-C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RGS3.
Información adicional
Size 100 ug
Gene Name RGS3
Gene Alias C2PA|FLJ20370|FLJ31516|FLJ90496|PDZ-RGS3|RGP3
Gene Description regulator of G-protein signaling 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS3 (AAH18072, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5998
Clone Number 1E8-C7
Iso type IgG1 Kappa

Enviar un mensaje


RGS3 monoclonal antibody (M01), clone 1E8-C7

RGS3 monoclonal antibody (M01), clone 1E8-C7