RGS3 purified MaxPab mouse polyclonal antibody (B01P)
  • RGS3 purified MaxPab mouse polyclonal antibody (B01P)

RGS3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005998-B01P
RGS3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RGS3 protein.
Información adicional
Size 50 ug
Gene Name RGS3
Gene Alias C2PA|FLJ20370|FLJ31516|FLJ90496|PDZ-RGS3|RGP3
Gene Description regulator of G-protein signaling 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5998

Enviar un mensaje


RGS3 purified MaxPab mouse polyclonal antibody (B01P)

RGS3 purified MaxPab mouse polyclonal antibody (B01P)