RFXAP monoclonal antibody (M01), clone 1B5
  • RFXAP monoclonal antibody (M01), clone 1B5

RFXAP monoclonal antibody (M01), clone 1B5

Ref: AB-H00005994-M01
RFXAP monoclonal antibody (M01), clone 1B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RFXAP.
Información adicional
Size 100 ug
Gene Name RFXAP
Gene Alias -
Gene Description regulatory factor X-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFXAP (NP_000529, 179 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5994
Clone Number 1B5
Iso type IgG2a Kappa

Enviar un mensaje


RFXAP monoclonal antibody (M01), clone 1B5

RFXAP monoclonal antibody (M01), clone 1B5