RFX2 polyclonal antibody (A01)
  • RFX2 polyclonal antibody (A01)

RFX2 polyclonal antibody (A01)

Ref: AB-H00005990-A01
RFX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFX2.
Información adicional
Size 50 uL
Gene Name RFX2
Gene Alias FLJ14226
Gene Description regulatory factor X, 2 (influences HLA class II expression)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PEQTMAVQSQHHQQYIDVSHVFPEFPAPDLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDPEGAVLPKDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFX2 (NP_000626, 323 a.a. ~ 429 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5990

Enviar un mensaje


RFX2 polyclonal antibody (A01)

RFX2 polyclonal antibody (A01)