RFX1 polyclonal antibody (A01)
  • RFX1 polyclonal antibody (A01)

RFX1 polyclonal antibody (A01)

Ref: AB-H00005989-A01
RFX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFX1.
Información adicional
Size 50 uL
Gene Name RFX1
Gene Alias EF-C
Gene Description regulatory factor X, 1 (influences HLA class II expression)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMTNGVAVGQQPSTGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFX1 (NP_002909, 502 a.a. ~ 600 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5989

Enviar un mensaje


RFX1 polyclonal antibody (A01)

RFX1 polyclonal antibody (A01)