RFPL1 polyclonal antibody (A01)
  • RFPL1 polyclonal antibody (A01)

RFPL1 polyclonal antibody (A01)

Ref: AB-H00005988-A01
RFPL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFPL1.
Información adicional
Size 50 uL
Gene Name RFPL1
Gene Alias MGC132428|RNF78
Gene Description ret finger protein-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFPL1 (NP_066306, 189 a.a. ~ 278 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5988

Enviar un mensaje


RFPL1 polyclonal antibody (A01)

RFPL1 polyclonal antibody (A01)