RFNG monoclonal antibody (M08), clone 6C7
  • RFNG monoclonal antibody (M08), clone 6C7

RFNG monoclonal antibody (M08), clone 6C7

Ref: AB-H00005986-M08
RFNG monoclonal antibody (M08), clone 6C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RFNG.
Información adicional
Size 100 ug
Gene Name RFNG
Gene Alias -
Gene Description RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFNG (AAC51359.1, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5986
Clone Number 6C7
Iso type IgG1 Kappa

Enviar un mensaje


RFNG monoclonal antibody (M08), clone 6C7

RFNG monoclonal antibody (M08), clone 6C7