RFC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • RFC4 purified MaxPab rabbit polyclonal antibody (D01P)

RFC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005984-D01P
RFC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RFC4 protein.
Información adicional
Size 100 ug
Gene Name RFC4
Gene Alias A1|MGC27291|RFC37
Gene Description replication factor C (activator 1) 4, 37kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RFC4 (NP_002907.1, 1 a.a. ~ 363 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5984

Enviar un mensaje


RFC4 purified MaxPab rabbit polyclonal antibody (D01P)

RFC4 purified MaxPab rabbit polyclonal antibody (D01P)