RFC3 polyclonal antibody (A01)
  • RFC3 polyclonal antibody (A01)

RFC3 polyclonal antibody (A01)

Ref: AB-H00005983-A01
RFC3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RFC3.
Información adicional
Size 50 uL
Gene Name RFC3
Gene Alias MGC5276|RFC38
Gene Description replication factor C (activator 1) 3, 38kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RFC3 (AAH00149, 257 a.a. ~ 356 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5983

Enviar un mensaje


RFC3 polyclonal antibody (A01)

RFC3 polyclonal antibody (A01)