REV3L polyclonal antibody (A01)
  • REV3L polyclonal antibody (A01)

REV3L polyclonal antibody (A01)

Ref: AB-H00005980-A01
REV3L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant REV3L.
Información adicional
Size 50 uL
Gene Name REV3L
Gene Alias POLZ|REV3
Gene Description REV3-like, catalytic subunit of DNA polymerase zeta (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen REV3L (NP_002903, 2953 a.a. ~ 3052 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5980

Enviar un mensaje


REV3L polyclonal antibody (A01)

REV3L polyclonal antibody (A01)