RENBP polyclonal antibody (A01)
  • RENBP polyclonal antibody (A01)

RENBP polyclonal antibody (A01)

Ref: AB-H00005973-A01
RENBP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RENBP.
Información adicional
Size 50 uL
Gene Name RENBP
Gene Alias RBP|RNBP
Gene Description renin binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RENBP (NP_002901, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5973

Enviar un mensaje


RENBP polyclonal antibody (A01)

RENBP polyclonal antibody (A01)