RELB MaxPab rabbit polyclonal antibody (D01)
  • RELB MaxPab rabbit polyclonal antibody (D01)

RELB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005971-D01
RELB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RELB protein.
Información adicional
Size 100 uL
Gene Name RELB
Gene Alias I-REL|IREL
Gene Description v-rel reticuloendotheliosis viral oncogene homolog B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RELB (NP_006500.2, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5971

Enviar un mensaje


RELB MaxPab rabbit polyclonal antibody (D01)

RELB MaxPab rabbit polyclonal antibody (D01)